| Cat.No.: | EAb-2405 |
| Product Overview: | Rabbit polyclonal to detect EHD2 |
| Antibody Type: | Polyclonal |
| Immunogen: | Recombinant fragment corresponding to Human EHD2 aa 401-543. |
| Immunogen Sequence: | ELESTEVGVQGGAFEGTHMGPFVERGPDEAMEDGEEGSDDEAEWVVTKDK SKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIWKLSDVDRDGM LDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE |
| Host: | Rabbit |
| Isotype: | IgG |
| Purification: | Protein G purified |
| Appearance: | Liquid |
| Formulation: | pH: 7.40; 0.03% Proclin, 50% Glycerol, PBS |
| Applications: | WB, IHC-P, ICC/IF |
| Species Reactivity: | Mouse, Human |
| Storage: | -20°C. |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Accession: | Q9NZN4 |
| Alternative Name: | EH domain containing 2 antibody/EH domain containing 3 antibody/EH domain containing protein 2 antibody |
| Scientific Background: | Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0025 | BIX01294 (hydrochloride hydrate) | Inquiry |
| BSM-0026 | UNC0224 | Inquiry |
| BSM-0027 | UNC0321 (trifluoroacetate salt) | Inquiry |
| ◆ Cell Lines | ||
| CL-0059 | Human EHMT1 Knockout Cell Line 7bp deletion | Inquiry |
| CL-0060 | Human EHMT2 Knockout Cell Line 34bp deletion | Inquiry |
| Related Gene / Proteins | |||
| EHD2 | EHMT1 | EHMT2 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools