EHD2 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-2405
Product Overview:  Rabbit polyclonal to detect EHD2
Antibody Type:  Polyclonal
Immunogen:  Recombinant fragment corresponding to Human EHD2 aa 401-543.
Immunogen Sequence:  ELESTEVGVQGGAFEGTHMGPFVERGPDEAMEDGEEGSDDEAEWVVTKDK SKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIWKLSDVDRDGM LDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKGSAE
Host:  Rabbit
Isotype:  IgG
Purification:  Protein G purified
Appearance:  Liquid
Formulation:  pH: 7.40; 0.03% Proclin, 50% Glycerol, PBS
Applications:  WB, IHC-P, ICC/IF
Species Reactivity:  Mouse, Human
Storage:  -20°C.
Warning:  For Research Use Only! Not For Use in Humans.
Accession:  Q9NZN4
Alternative Name:  EH domain containing 2 antibody/EH domain containing 3 antibody/EH domain containing protein 2 antibody
Scientific Background:  Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.
Product Types
◆ Bioactive Small Molecules
BSM-0025 BIX01294 (hydrochloride hydrate) Inquiry
BSM-0026 UNC0224 Inquiry
BSM-0027 UNC0321 (trifluoroacetate salt) Inquiry
◆ Cell Lines
CL-0059 Human EHMT1 Knockout Cell Line 7bp deletion Inquiry
CL-0060 Human EHMT2 Knockout Cell Line 34bp deletion Inquiry
Related Gene / Proteins
EHD2 EHMT1 EHMT2

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart