| Cat.No.: | EAb-0477 |
| Antibody Type: | Polyclonal |
| Immunogen: | This antibody was developed against a recombinant protein corresponding to amino acids: RVLELYSGVGGMHHALRESCIPAQVVAAIDVNTVANEVYKYNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRT |
| Host: | Rabbit |
| Isotype: | IgG |
| Antibody Target: | TRDMT1 |
| Specificity: | Specificity of human Dnmt2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Purification: | Immunogen affinity purified |
| Appearance: | Liquid |
| Formulation: | PBS (pH 7.2) and 40% Glycerol |
| Applications: | WB, IHC, IHC-P |
| Recommended Dilutions/Conditions: |
Western Blot 0.4 ug/ml; Immunohistochemistry 1:50 - 1:200; Immunohistochemistry-Paraffin 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Human |
| Storage: | -20°C |
| Storage Buffer: | 0.02% Sodium Azide |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Alternative Name: | DMNT2; DNA (cytosine-5-)-methyltransferase 2; DNA (cytosine-5)-methyltransferase-like protein 2; DNA methyltransferase homolog HsaIIP; DNA methyltransferase-2; DNA MTase homolog HsaIIP; DNMT2; EC 2.1.1; EC 2.1.1.29; M.HsaIIP; MHSAIIP; PUMET; RNMT1; tRNA (cytosine-5-)-methyltransferase; tRNA aspartic acid methyltransferase 1 |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0008 | Vinorelbine Tartrate | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0027 | Recombinant Human DNMT3A 293 Cell Lysate | Inquiry |
| EL-0028 | Recombinant Human DNMT3B 293 Cell Lysate | Inquiry |
| EL-0029 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| EL-0030 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| DNA alkyltransferase | DNAJC2 | DNAS1L1 | DNASE1L3 |
| DNMT | DNMT1 | DNMT2 | DNMT3A |
| DNMT3B | DNMT3L | DNMT4 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.