Cat.No.: | EAb-0476 |
Product Name: | Dnmt2 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | This antibody was developed against a recombinant protein corresponding to amino acids: KIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYAL |
Host: | Rabbit |
Isotype: | IgG |
Antibody Target: | TRDMT1 |
Specificity: | Specificity of human Dnmt2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Purification: | Immunogen affinity purified |
Appearance: | Liquid |
Formulation: | PBS (pH 7.2) and 40% Glycerol |
Applications: | ICC/IF, IHC, IHC-P |
Recommended Dilutions/Conditions: |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml; Immunohistochemistry 1:50 - 1:200; Immunohistochemistry-Paraffin 1:50 - 1:200 Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Species Reactivity: | Human |
Storage: | -20°C |
Storage Buffer: | 0.02% Sodium Azide |
Warning: | For Research Use Only! Not For Use in Humans. |
Alternative Name: | DMNT2; DNA (cytosine-5-)-methyltransferase 2; DNA (cytosine-5)-methyltransferase-like protein 2; DNA methyltransferase homolog HsaIIP; DNA methyltransferase-2; DNA MTase homolog HsaIIP; DNMT2; EC 2.1.1; EC 2.1.1.29; M.HsaIIP; MHSAIIP; PUMET; RNMT1; tRNA (cytosine-5-)-methyltransferase; tRNA aspartic acid methyltransferase 1 |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0008 | Vinorelbine Tartrate | Inquiry |
◆ Extracts & Lysates | ||
EL-0027 | Recombinant Human DNMT3A 293 Cell Lysate | Inquiry |
EL-0028 | Recombinant Human DNMT3B 293 Cell Lysate | Inquiry |
EL-0029 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
EL-0030 | Recombinant Human DNMT3L 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
DNA alkyltransferase | DNAJC2 | DNAS1L1 | DNASE1L3 |
DNMT | DNMT1 | DNMT2 | DNMT3A |
DNMT3B | DNMT3L | DNMT4 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools