Dnmt2 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-0476
Product Name:  Dnmt2 Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  This antibody was developed against a recombinant protein corresponding to amino acids: KIESVHPQKYAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQYLLPPKSLLRYAL
Host:  Rabbit
Isotype:  IgG
Antibody Target:  TRDMT1
Specificity:  Specificity of human Dnmt2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification:  Immunogen affinity purified
Appearance:  Liquid
Formulation:  PBS (pH 7.2) and 40% Glycerol
Applications:  ICC/IF, IHC, IHC-P
Recommended Dilutions/Conditions:  Immunocytochemistry/Immunofluorescence 1-4 ug/ml; Immunohistochemistry 1:50 - 1:200; Immunohistochemistry-Paraffin 1:50 - 1:200
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Species Reactivity:  Human
Storage:  -20°C
Storage Buffer:  0.02% Sodium Azide
Warning:  For Research Use Only! Not For Use in Humans.
Alternative Name:  DMNT2; DNA (cytosine-5-)-methyltransferase 2; DNA (cytosine-5)-methyltransferase-like protein 2; DNA methyltransferase homolog HsaIIP; DNA methyltransferase-2; DNA MTase homolog HsaIIP; DNMT2; EC 2.1.1; EC 2.1.1.29; M.HsaIIP; MHSAIIP; PUMET; RNMT1; tRNA (cytosine-5-)-methyltransferase; tRNA aspartic acid methyltransferase 1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.