JMJD2B Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-0473
Product Name:  JMJD2B Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRLSLSTGAPQEPAFSGEEAKAAKRPRVGTPLATEDSGRSQDYVAFVESLLQVQG
Host:  Rabbit
Isotype:  IgG
Antibody Target:  KDM4B
Specificity:  Specificity of human JMJD2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification:  Affinity purified
Appearance:  Liquid
Formulation:  PBS (pH 7.2) and 40% Glycerol
Applications:  ICC/IF
Recommended Dilutions/Conditions:  Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Species Reactivity:  Human
Storage:  -20°C
Storage Buffer:  0.02% Sodium Azide
Warning:  For Research Use Only! Not For Use in Humans.
Alternative Name:  EC 1.14.11; FLJ44906; JHDM3B; JmjC domain-containing histone demethylation protein 3B; JMJD2BEC 1.14.11.-; jumonji domain containing 2B; Jumonji domain-containing protein 2B; KIAA0876lysine-specific demethylase 4B; lysine (K)-specific demethylase 4B

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.