| Cat.No.: | EAb-0458 |
| Product Name: | LSD1 Polyclonal Antibody |
| Antibody Type: | Polyclonal |
| Immunogen: | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY |
| Host: | Rabbit |
| Isotype: | IgG |
| Antibody Target: | KDM1A |
| Specificity: | Specificity of human LSD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Purification: | Affinity purified |
| Appearance: | Liquid |
| Formulation: | PBS (pH 7.2) and 40% Glycerol |
| Applications: | ICC/IF |
| Recommended Dilutions/Conditions: |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
| Species Reactivity: | Human, Mouse, Rat |
| Storage: | -20°C |
| Storage Buffer: | 0.02% Sodium Azide |
| Warning: | For Research Use Only! Not For Use in Humans. |
| Alternative Name: | amine oxidase (flavin containing) domain 2; AOF2; AOF2lysine-specific histone demethylase 1; BHC110; BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit; Flavin-containing amine oxidase domain-containing protein 2; KIAA0601KDM1; LSD1; LSD1BRAF35-HDAC complex protein BHC110; lysine (K)-specific demethylase 1; Lysine (K)specific Demethylase 1A; Lysine (K)-specific Demethylase 1A; lysine-specific histone demethylase 1A |
| Product Types | ||
| ◆ Research Kits | ||
| EKIT-0062 | Histone Demethylase LSD1 Activity/Inhibition Assay Kit | Inquiry |
| EKIT-0126 | LSD1 Inhibitor Screening Assay Kit | Inquiry |
| EKIT-0160 | LSD1 Demethylase Activity/Inhibition Fluorometric Assay Kit | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0111 | DDP-38003 dihydrochloride | Inquiry |
| BSM-0141 | GSK-LSD1 dihydrochloride | Inquiry |
| Related Gene / Proteins | |||
| LSD1 | LSD2 | LSM2 | LSM3 |
| LSM5 | LSM6 | LSP1 | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
