LSD1 Polyclonal Antibody


  • Specification
  • Target Information
  • Related Products
Cat.No.:  EAb-0458
Product Name:  LSD1 Polyclonal Antibody
Antibody Type:  Polyclonal
Immunogen:  This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIY
Host:  Rabbit
Isotype:  IgG
Antibody Target:  KDM1A
Specificity:  Specificity of human LSD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification:  Affinity purified
Appearance:  Liquid
Formulation:  PBS (pH 7.2) and 40% Glycerol
Applications:  ICC/IF
Recommended Dilutions/Conditions:  Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user.
Species Reactivity:  Human, Mouse, Rat
Storage:  -20°C
Storage Buffer:  0.02% Sodium Azide
Warning:  For Research Use Only! Not For Use in Humans.
Alternative Name:  amine oxidase (flavin containing) domain 2; AOF2; AOF2lysine-specific histone demethylase 1; BHC110; BHC110FAD-binding protein BRAF35-HDAC complex, 110 kDa subunit; Flavin-containing amine oxidase domain-containing protein 2; KIAA0601KDM1; LSD1; LSD1BRAF35-HDAC complex protein BHC110; lysine (K)-specific demethylase 1; Lysine (K)specific Demethylase 1A; Lysine (K)-specific Demethylase 1A; lysine-specific histone demethylase 1A

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.