Cat.No.: | EAb-0429 |
Product Name: | SIRT6 Polyclonal Antibody |
Antibody Type: | Polyclonal |
Immunogen: | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHL |
Host: | Rabbit |
Isotype: | IgG |
Antibody Target: | SIRT6 |
Specificity: | Specificity of human SIRT6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Purification: | Affinity purified |
Appearance: | Liquid |
Formulation: | PBS (pH 7.2) and 40% Glycerol |
Applications: | ICC/IF |
Recommended Dilutions/Conditions: |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml Recommended dilutions/conditions may not be available for all applications. Specific conditions for reactivity should be optimized by the end user. |
Species Reactivity: | Human, Mouse, Rat |
Storage: | -20°C |
Storage Buffer: | 0.02% Sodium Azide |
Warning: | For Research Use Only! Not For Use in Humans. |
Alternative Name: | EC 3.5.1.-; NAD-dependent deacetylase sirtuin-6; SIR2L6sir2-related protein type 6; SIR2-like protein 6; sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae); sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 6; sirtuin 6; sirtuin type 6 |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0016 | Recombinant Human SIRT1 Lysate | Inquiry |
EL-0017 | Recombinant Human SIRT2 293 Cell Lysate | Inquiry |
EL-0018 | Recombinant Human SIRT3 293 Cell Lysate | Inquiry |
◆ Synthetic Peptides | ||
SP-0017 | Fluorogenic Sirtuin 5 Substrate | Inquiry |
SP-0018 | Fluorogenic Sirtuin 6 Substrate | Inquiry |
Related Gene / Proteins | |||
Siah2 | SIK1 | SIMC1 | SIN3A |
SIN3B | SIP1 | Sir2p | SIRT |
SIRT1 | SIRT2 | SIRT3 | SIRT4 |
SIRT5 | sirt6 | SIRT7 | SIX3 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools