| Cat.No.: | PE-2996 |
| Background: | Binds to heterochromatin. Does not interact with either methylated or unmethylated DNA (in vitro). |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | 9430004D19Rik/AA536666/AI426407 |
| Tag: | GST |
| Amino Acid Sequence: | MFPPTANMLLPTGEGQSGRAALRDKLMSQQKDALRKRKQPPTTVLSLLRQ SQMDSSAVPKPGPDLLRKQGQGSFPISSMSQLLQSMSCQSSHLSSNSTPG CGASNTALPCSANQLHFTDPSMNSSVLQNIPLRGEAVHCHNANTNFVHSN SPVPNHHLAGLINQIQASGNCGMLSQSGMALGNSLHPNPPQSRISTSSTP VIPNSIVSSYNQTSSEAGMVLLEKSTQRY |
| Sequence Similarities: | Contains 1 MBD (methyl-CpG-binding) domain.Contains 1 PWWP domain. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 229 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0001 | Recombinant Human MBD1 Cell Lysate | Inquiry |
| EL-0002 | Recombinant Human MBD3 Cell Lysate | Inquiry |
| EL-0003 | Recombinant Human MBD3L1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0001 | Recombinant Chicken MBD2 | Inquiry |
| PE-0002 | Recombinant Zebrafish MBD2 | Inquiry |
| Related Gene / Proteins | |||
| MBD1 | mbd2 | MBD3 | MBD3L1 |
| MBD3L2 | MBD3L3 | MBD3L4 | MBD3L5 |
| MBD4 | MBD5 | MBD6 | MBIP |
| MBTD1 | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.