Cat.No.: | PE-2991 |
Product Name: | Recombinant Human MBD2 Interacting Zinc Finger MIZF protein |
Background: | Transcriptional repressor that binds to the consensus sequence 5'-CGGACGTT-3' and to the RB1 promoter. Transcriptional activator that promotes histone H4 gene transcription at the G1/S phase transition in conjunction with NPAT. Also activates transcription of the ATM and PRKDC genes. Autoregulates its expression by associating with its own promoter. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | DKFZp434F162/HiNF-P/HINFP |
Tag: | GST |
Amino Acid Sequence: | MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEE EEEEEEDDPLEEEFSCLWQECGFCSLDSSADLIRHVYFHCYHTKLKQWGL QALQSQADLG |
Sequence Similarities: | Contains 9 C2H2-type zinc fingers. |
Expression System: | Wheat germ |
Post Translational Modifications: | Ubiquitinated. Ubiquitination may lead to proteasome-mediated degradation. |
Protein Length: | Protein fragment; 1 to 110 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0001 | Recombinant Human MBD1 Cell Lysate | Inquiry |
EL-0002 | Recombinant Human MBD3 Cell Lysate | Inquiry |
EL-0003 | Recombinant Human MBD3L1 293 Cell Lysate | Inquiry |
◆ Proteins & Enzymes | ||
PE-0001 | Recombinant Chicken MBD2 | Inquiry |
PE-0002 | Recombinant Zebrafish MBD2 | Inquiry |
Related Gene / Proteins | |||
MBD1 | mbd2 | MBD3 | MBD3L1 |
MBD3L2 | MBD3L3 | MBD3L4 | MBD3L5 |
MBD4 | MBD5 | MBD6 | MBIP |
MBTD1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools