Recombinant Human MGMT protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2981
Background:  Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.
Applications:  SDS-PAGE; HPLC
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  24 kDa including tags
Purity:  > 95 % by SEC-HPLC and reducing SDS-PAGE.
Species:  Human
Formulation:  pH: 8.0; Constituents: 0.32% Tris-HCl buffer, 0.03% EDTA
Accession#:  P16455
Alternative Names:  6 O methylguanine DNA methyltransferase/6-O-methylguanine-DNA methyltransferase/Agat
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHE IKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAV GGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG LGGSSGLAGAWLKGAGATSGSPPAGRN
Sequence Similarities:  Belongs to the MGMT family.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 207
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Extracts & Lysates
EL-0142 Recombinant Human MGMT Cell Lysate Inquiry
◆ Bioactive Small Molecules
BSM-0164 Lomeguatrib Inquiry
◆ Antibodies
EAb-0230 O6-Methylguanine-DNA methyltransferase Polyclonal Antibody Inquiry
EAb-0351 MGMT Polyclonal Antibody Inquiry
◆ Cell Lines
CL-0394 Human MGMT Knockout Cell Line 2bp deletion Inquiry
Related Gene / Proteins
MGMT

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.