| Cat.No.: | PE-2981 |
| Product Name: | Recombinant Human MGMT protein |
| Background: | Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. |
| Applications: | SDS-PAGE; HPLC |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 24 kDa including tags |
| Purity: | > 95 % by SEC-HPLC and reducing SDS-PAGE. |
| Species: | Human |
| Formulation: | pH: 8.0; Constituents: 0.32% Tris-HCl buffer, 0.03% EDTA |
| Accession#: | P16455 |
| Alternative Names: | 6 O methylguanine DNA methyltransferase/6-O-methylguanine-DNA methyltransferase/Agat |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHE IKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAV GGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG LGGSSGLAGAWLKGAGATSGSPPAGRN |
| Sequence Similarities: | Belongs to the MGMT family. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 207 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0142 | Recombinant Human MGMT Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0164 | Lomeguatrib | Inquiry |
| ◆ Antibodies | ||
| EAb-0230 | O6-Methylguanine-DNA methyltransferase Polyclonal Antibody | Inquiry |
| EAb-0351 | MGMT Polyclonal Antibody | Inquiry |
| ◆ Cell Lines | ||
| CL-0394 | Human MGMT Knockout Cell Line 2bp deletion | Inquiry |
| Related Gene / Proteins | |||
| MGMT | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools