Cat.No.: | PE-2981 |
Product Name: | Recombinant Human MGMT protein |
Background: | Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated. |
Applications: | SDS-PAGE; HPLC |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 24 kDa including tags |
Purity: | > 95 % by SEC-HPLC and reducing SDS-PAGE. |
Species: | Human |
Formulation: | pH: 8.0; Constituents: 0.32% Tris-HCl buffer, 0.03% EDTA |
Accession#: | P16455 |
Alternative Names: | 6 O methylguanine DNA methyltransferase/6-O-methylguanine-DNA methyltransferase/Agat |
Tag: | His |
Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHE IKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFP VPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAV GGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG LGGSSGLAGAWLKGAGATSGSPPAGRN |
Sequence Similarities: | Belongs to the MGMT family. |
Expression System: | E. coli |
Protein Length: | Full length protein; 1 to 207 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Extracts & Lysates | ||
EL-0142 | Recombinant Human MGMT Cell Lysate | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0164 | Lomeguatrib | Inquiry |
◆ Antibodies | ||
EAb-0230 | O6-Methylguanine-DNA methyltransferase Polyclonal Antibody | Inquiry |
EAb-0351 | MGMT Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0394 | Human MGMT Knockout Cell Line 2bp deletion | Inquiry |
Related Gene / Proteins | |||
MGMT |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools