Recombinant Human HMGB2 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2975
Background:  DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS).
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  26 kDa including tags
Purity:  > 90 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 0.058% Sodium chloride
Accession#:  P26583
Alternative Names:  C80539/High mobility group (nonhistone chromosomal) protein 2/High mobility group box 2
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHTGSMGKGDPNKPRGKMSSYAFFVQTCREEH KKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKN YVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAK KLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGR PTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Sequence Similarities:  Belongs to the HMGB family.Contains 2 HMG box DNA-binding domains.
Expression System:  Baculovirus
Protein Length:  Full length protein; 1 to 209
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.