Recombinant Human HMGB2 protein

Cat.No.:	PE-2975
Product Name:	Recombinant Human HMGB2 protein
Background:	DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS).
Applications:	SDS-PAGE
Storage:	Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:	Liquid
Molecular Weight:	26 kDa including tags
Purity:	> 90 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:	Human
Formulation:	pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 0.058% Sodium chloride
Accession#:	P26583
Alternative Names:	C80539/High mobility group (nonhistone chromosomal) protein 2/High mobility group box 2
Tag:	His
Amino Acid Sequence:	MGSSHHHHHHSSGLVPRGSHTGSMGKGDPNKPRGKMSSYAFFVQTCREEH KKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKN YVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAK KLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGR PTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Sequence Similarities:	Belongs to the HMGB family.Contains 2 HMG box DNA-binding domains.
Expression System:	Baculovirus
Protein Length:	Full length protein; 1 to 209
Warning:	This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Products