Recombinant human Dnmt3L protein


  • Specification
  • Related Products
Cat.No.:  PE-2966
Product Name:  Recombinant human Dnmt3L protein
Background:  Catalytically inactive regulatory factor of DNA methyltransferases. It is essential for the function of DNMT3A and DNMT3B. Activates DNMT3A and DNMT3B by binding to their catalytic domain. Accelerates the binding of DNA and AdoMet to the methyltransferases and dissociates from the complex after DNA binding to the methyltransferases. Recognizes unmethylated histone H3 lysine 4 (H3K4) and induces de novo DNA methylation by recruitment or activation of DNMT3.
Applications:  Functional Studies; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  70 kDa including tags
Purity:  > 80 % Densitometry.
Species:  Human
Formulation:  pH: 7.50; Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.03% EDTA, 25% Glycerol, 0.29% Sodium chloride
Accession#:  Q9UJW3
Alternative Names:  Cytosine 5 methyltransferase 3 like protein/DNA (cytosine 5 ) methyltransferase 3 like/DNA (cytosine-5)-methyltransferase 3-like
Amino Acid Sequence:  MAAIPALDPEAEPSMDVILVGSSELSSSVSPGTGRDLIAYEVKANQRNIE DICICCGSLQVHTQHPLFEGGICAPCKDKFLDALFLYDDDGYQSYCSICC SGETLLICGNPDCTRCYCFECVDSLVGPGTSGKVHAMSNWVCYLCLPSSR SGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIK KELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGH TCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASR FLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNK QSSKLAAKWPTKLVKNCFLPLREYFKYFSTELTSSL
Sequence Similarities:  Belongs to the C5-methyltransferase family.Contains 1 ADD-type zinc finger.
Expression System:  Sf9 Insect Cells
Protein Length:  Full length protein; 1 to 386
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.