| Cat.No.: | PE-2956 |
| Product Name: | Recombinant Human MBD1 protein |
| Background: | Transcriptional repressor that binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binding is abolished by the presence of 7-mG that is produced by DNA damage by methylmethanesulfonate (MMS). Acts as transcriptional repressor and plays a role in gene silencing by recruiting AFT7IP, which in turn recruits factors such as the histone methyltransferase SETDB1. Probably forms a complex with SETDB1 and ATF7IP that represses transcription and couples DNA methylation and histone 'Lys-9' trimethylation. Isoform 1 and isoform 2 can also repress transcription from unmethylated promoters. |
| Applications: | ELISA; SDS-PAGE; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | Q9UIS9 |
| Alternative Names: | CXXC 3/CXXC-type zinc finger protein 3/CXXC3 |
| Amino Acid Sequence: | HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGAS SPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE |
| Sequence Similarities: | Contains 3 CXXC-type zinc fingers.Contains 1 MBD (methyl-CpG-binding) domain. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Sumoylated with SUMO1 by PIAS1 and PIAS3. Sumoylation affects transcriptional silencing by preventing the interaction with SETDB1. In contrast, sumoylation may increase interaction with AFT7IP.Phosphorylated upon DNA damage, probably by ATM or ATR. |
| Protein Length: | Protein fragment; 415 to 508 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0001 | Recombinant Human MBD1 Cell Lysate | Inquiry |
| EL-0002 | Recombinant Human MBD3 Cell Lysate | Inquiry |
| EL-0003 | Recombinant Human MBD3L1 293 Cell Lysate | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0001 | Recombinant Chicken MBD2 | Inquiry |
| PE-0002 | Recombinant Zebrafish MBD2 | Inquiry |
| Related Gene / Proteins | |||
| MBD1 | mbd2 | MBD3 | MBD3L1 |
| MBD3L2 | MBD3L3 | MBD3L4 | MBD3L5 |
| MBD4 | MBD5 | MBD6 | MBIP |
| MBTD1 | |||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools