Cat.No.: | PE-2947 |
Product Name: | Recombinant Human Histone H1 protein |
Background: | May play a key role in the control of gene expression during oogenesis and early embryogenesis, presumably through the perturbation of chromatin structure. Essential for meiotic maturation of germinal vesicle-stage oocytes. The somatic type linker histone H1c is rapidly replaced by H1oo in a donor nucleus transplanted into an oocyte. The greater mobility of H1oo as compared to H1c may contribute to this rapid replacement and increased instability of the embryonic chromatin structure. The rapid replacement of H1c with H1oo may play an important role in nuclear remodeling. |
Applications: | SDS-PAGE |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 22 kDa including tags |
Purity: | >82 % SDS-PAGE. |
Species: | Human |
Formulation: | pH: 7.40; Constituents: 79% PBS, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol |
Accession#: | P07305 |
Alternative Names: | dJ221C16.2/dJ221C16.5/DmeH1 |
Tag: | His |
Amino Acid Sequence: | MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAG SSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFR LAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVK KAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |
Sequence Similarities: | Belongs to the histone H1/H5 family.Contains 1 H15 (linker histone H1/H5 globular) domain. |
Expression System: | E. coli |
Protein Length: | Full length protein; 2 to 194 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Nucleosomes | ||
NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
◆ Synthetic Peptides | ||
SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
SP-0010 | Histone H4 peptide (1-21) | Inquiry |
SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
Related Gene / Proteins | |||
HIC1 | HIF1A | HIF1AN | HINFP |
HIPK1 | HIPK2 | HIRA | Histone |
Histone H1 | Histone H2A | Histone H2B | Histone H3 |
Histone H4 | HIV-1 reverse transcriptase |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools