Recombinant Human Histone H1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2947
Product Name:  Recombinant Human Histone H1 protein
Background:  May play a key role in the control of gene expression during oogenesis and early embryogenesis, presumably through the perturbation of chromatin structure. Essential for meiotic maturation of germinal vesicle-stage oocytes. The somatic type linker histone H1c is rapidly replaced by H1oo in a donor nucleus transplanted into an oocyte. The greater mobility of H1oo as compared to H1c may contribute to this rapid replacement and increased instability of the embryonic chromatin structure. The rapid replacement of H1c with H1oo may play an important role in nuclear remodeling.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  22 kDa including tags
Purity:  >82 % SDS-PAGE.
Species:  Human
Formulation:  pH: 7.40; Constituents: 79% PBS, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol
Accession#:  P07305
Alternative Names:  dJ221C16.2/dJ221C16.5/DmeH1
Tag:  His
Amino Acid Sequence:  MHHHHHHTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAG SSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFR LAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVK KAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Sequence Similarities:  Belongs to the histone H1/H5 family.Contains 1 H15 (linker histone H1/H5 globular) domain.
Expression System:  E. coli
Protein Length:  Full length protein; 2 to 194
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.