| Cat.No.: | PE-2941 |
| Background: | Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. |
| Applications: | ELISA; Western blot; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 36 kDa including tags |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Accession#: | P52926 |
| Alternative Names: | HMGA 2/BABL/High mobility group (nonhistone chromosomal) protein isoform I C |
| Amino Acid Sequence: | MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRG RPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP |
| Sequence Similarities: | Belongs to the HMGA family.Contains 3 A.T hook DNA-binding domains. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Regulated by cell cycle-dependent phosphorylation which alters its DNA binding affinity. |
| Protein Length: | Protein fragment; 1 to 92 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
| EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
| EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
| EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
| EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.