Recombinant Human HMGA2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2941
Product Name:  Recombinant Human HMGA2 protein
Background:  Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2.
Applications:  ELISA; Western blot; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  36 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  P52926
Alternative Names:  HMGA 2/BABL/High mobility group (nonhistone chromosomal) protein isoform I C
Amino Acid Sequence:  MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRG RPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP
Sequence Similarities:  Belongs to the HMGA family.Contains 3 A.T hook DNA-binding domains.
Expression System:  Wheat germ
Post Translational Modifications:  Regulated by cell cycle-dependent phosphorylation which alters its DNA binding affinity.
Protein Length:  Protein fragment; 1 to 92
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.