Recombinant Human HIRA/HIR protein


  • Specification
  • Related Products
Cat.No.:  PE-2932
Product Name:  Recombinant Human HIRA/HIR protein
Background:  Cooperates with ASF1A to promote replication-independent chromatin assembly. Required for the periodic repression of histone gene transcription during the cell cycle. Required for the formation of senescence-associated heterochromatin foci (SAHF) and efficient senescence-associated cell cycle exit.
Applications:  Western blot; SDS-PAGE; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  38 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  P54198
Alternative Names:  DGCR1/DiGeorge critical region gene 1/HIR
Amino Acid Sequence:  HVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLRE ICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTEC QEQLDILRDK
Sequence Similarities:  Belongs to the WD repeat HIR1 family.Contains 8 WD repeats.
Expression System:  Wheat germ
Post Translational Modifications:  Sumoylated.Phosphorylated by CDK2/CCNA1 and CDK2/CCNE1 on Thr-555 in vitro. Also phosphorylated on Thr-555 and Ser-687 in vivo.
Protein Length:  Protein fragment; 908 to 1017
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.