Recombinant Human Histone H1.0 protein


  • Specification
  • Related Products
Cat.No.:  PE-2918
Product Name:  Recombinant Human Histone H1.0 protein
Background:  Histones H1 are necessary for the condensation of nucleosome chains into higher-order structures. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  47 kDa including tags
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Accession#:  P07305
Alternative Names:  H1 histone family member 0/H1(0)/H10
Tag:  GST
Amino Acid Sequence:  MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSI QKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDE PKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKL AATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Sequence Similarities:  Belongs to the histone H1/H5 family.Contains 1 H15 (linker histone H1/H5 globular) domain.
Expression System:  Wheat germ
Post Translational Modifications:  Phosphorylated on Ser-17 in RNA edited version.
Protein Length:  Full length protein; 1 to 194
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.