| Cat.No.: | PE-2910 |
| Background: | HMG2L1 (High mobility group protein 2-like 1) contains an HMG box which is involved in DNA binding. The high mobility group (HMG) proteins are nonhistone chromosomal proteins. HMG1 and HMG2 are localized in the nuclei of higher eukaryotes, bind to single-stranded DNA, unwind double-stranded DNA, and increase transcription. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | High mobility group protein 2 like 1/HMG box domain containing 4/HMGBCG |
| Tag: | GST |
| Amino Acid Sequence: | MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQ VRNSSKKKLKDSELYFLGTDTHKK |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1 to 74 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
| EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
| EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
| EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
| EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools