Recombinant Human HMG2L1 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2910
Background:  HMG2L1 (High mobility group protein 2-like 1) contains an HMG box which is involved in DNA binding. The high mobility group (HMG) proteins are nonhistone chromosomal proteins. HMG1 and HMG2 are localized in the nuclei of higher eukaryotes, bind to single-stranded DNA, unwind double-stranded DNA, and increase transcription.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  High mobility group protein 2 like 1/HMG box domain containing 4/HMGBCG
Tag:  GST
Amino Acid Sequence:  MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQ VRNSSKKKLKDSELYFLGTDTHKK
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1 to 74
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.