Cat.No.: | PE-2901 |
Product Name: | Recombinant Human Histone H1.1 protein |
Background: | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. The C-terminal domain is the primary determinant of histone H1 binding to chromatin in vivo. The C-terminal region also shows the most differences in aa sequence between the H1 histone variants H1.0/1/2/3/4/5. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | H1 histone family member 1/H1.1/H1F1 |
Tag: | GST |
Amino Acid Sequence: | MSETVPPAPAASAAPEKPLAGKKAKKPAKAAAASKKKPAGPSVSELIVQA ASSSKERGGVSLAALKKALAAAGYDVEKNNSRIKLGIKSLVSKGTLVQTK GTGASGSFKLNKKASSVETKPGASKVATKTKATGASKKLKKATGASKKSV KTPKKAKKPAATRKSSKNPKKPKTVKPKKVAKSPAKAKAVKPKAAKARVT KPKTAKPKKAAPKKK |
Expression System: | Wheat germ |
Protein Length: | Full length protein; 1 to 215 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Nucleosomes | ||
NUC-0007 | Recombinant Tetranucleosomes H3.3 | Inquiry |
NUC-0008 | Recombinant Mononucleosomes H3.3 | Inquiry |
◆ Synthetic Peptides | ||
SP-0009 | Histone H4 peptide (1-21), Biotin-labeled | Inquiry |
SP-0010 | Histone H4 peptide (1-21) | Inquiry |
SP-0012 | Histone H3 peptide (21-44), Biotin-labeled | Inquiry |
Related Gene / Proteins | |||
HIC1 | HIF1A | HIF1AN | HINFP |
HIPK1 | HIPK2 | HIRA | Histone |
Histone H1 | Histone H2A | Histone H2B | Histone H3 |
Histone H4 | HIV-1 reverse transcriptase |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools