Recombinant Human MAGOH protein


  • Specification
  • Related Products
Cat.No.:  PE-2885
Product Name:  Recombinant Human MAGOH protein
Background:  Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Remains associated with the mRNA after its export to the cytoplasm and require translation of the mRNA for removal. The heterodimer MAGOH-RBM8A interacts with PYM that function to enhance the translation of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  18 kDa including tags
Purity:  > 90 % SDS-PAGE. Purified by proprietary chromatographic techniques.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.03% DTT
Accession#:  P61326
Alternative Names:  Mago nashi homolog proliferation associated (Drosophila)/Mago nashi protein homolog/magoh
Tag:  His
Amino Acid Sequence:  MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEA YVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFT TSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPILEHH HHHH
Sequence Similarities:  Belongs to the mago nashi family.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 146
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.