| Cat.No.: | PE-2876 |
| Background: | May play a role in host defense against tumors and pathogens. Binds Z-DNA. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | C20orf183/DAI/DLM 1 |
| Tag: | GST |
| Amino Acid Sequence: | MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLY RMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPGNCHPGEAGLTLQG ASWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTAGLLGRGC |
| Sequence Similarities: | Contains 2 DRADA repeats. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 149 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0165 | Human DAND5 Knockout Cell Line | Inquiry |
| ◆ Antibodies | ||
| EAb-2023 | DAX-1 / NR0B1 Monoclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2534 | Recombinant Human Deleted in azoospermia 4 protein | Inquiry |
| PE-2542 | Recombinant Human DAZAP1 protein | Inquiry |
| PE-2543 | Recombinant Human DAZAP1 protein | Inquiry |
| Related Gene / Proteins | |||
| DAI | DAND5 | DAX-1 | Daxx |
| DAZ1 | DAZ3 | DAZ4 | DAZAP1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.