| Cat.No.: | PE-2871 |
| Background: | Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 11 kDa including tags |
| Purity: | > 95 % SDS-PAGE. Purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 50% Glycerol, 0.58% Sodium chloride |
| Accession#: | P62308 |
| Alternative Names: | MGC117317/RUXG_HUMAN/Sm protein G |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMSKAHPPELKKFMDKKLSLKLNGGRHVQGI LRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV |
| Sequence Similarities: | Belongs to the snRNP Sm proteins family. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 76 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0784 | Swi2/SNF2 Polyclonal Antibody | Inquiry |
| EAb-0790 | SNFa/BRM Polyclonal Antibody | Inquiry |
| EAb-1821 | SNAI1 / Snail Monoclonal Antibody | Inquiry |
| EAb-1983 | SND1 Monoclonal Antibody | Inquiry |
| EAb-2014 | SNF5 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| SNAI1 | Snail | SND1 | SNF2 |
| SNF2L1 | SNF5 | SNFa | SNRP70 |
| SNRPG | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.