Recombinant Human SNRPG protein


  • Specification
  • Related Products
Cat.No.:  PE-2871
Product Name:  Recombinant Human SNRPG protein
Background:  Appears to function in the U7 snRNP complex that is involved in histone 3'-end processing. Associated with snRNP U1, U2, U4/U6 and U5.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  11 kDa including tags
Purity:  > 95 % SDS-PAGE. Purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 50% Glycerol, 0.58% Sodium chloride
Accession#:  P62308
Alternative Names:  MGC117317/RUXG_HUMAN/Sm protein G
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMSKAHPPELKKFMDKKLSLKLNGGRHVQGI LRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Sequence Similarities:  Belongs to the snRNP Sm proteins family.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 76
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.