| Cat.No.: | PE-2870 |
| Background: | Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding. |
| Applications: | Mass Spectrometry; SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 17 kDa including tags |
| Purity: | > 85 % SDS-PAGE. Purified by using conventional chromatography. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride |
| Accession#: | P37108 |
| Alternative Names: | 18 kDa Alu RNA binding protein/18 kDa Alu RNA-binding protein/Alu RNA-binding protein, 14-KD subunit |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSHMVLLESEQFLTELTRLFQKCRTSGSV YITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKK ISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAA PAAAATAATTAATTAATAAQ |
| Sequence Similarities: | Belongs to the SRP14 family. |
| Expression System: | E. coli |
| Protein Length: | Full length protein; 1 to 160 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Research Kits | ||
| EKIT-0422 | SREBP-2 Transcription Factor Assay Kit | Inquiry |
| EKIT-0426 | SREBP-1 Transcription Factor Assay Kit | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0560 | Recombinant Human SRF | Inquiry |
| PE-0561 | Recombinant Human SRF, His-tagged | Inquiry |
| PE-0562 | Recombinant Human SRF, His-tagged | Inquiry |
| Related Gene / Proteins | |||
| SRBD1 | SRC1 | SREBP | SREBP-1 |
| SREBP-2 | SRF | SRP14 | SRP19 |
| SRY | |||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.