Recombinant Human SRP14 protein


  • Specification
  • Related Products
Cat.No.:  PE-2870
Product Name:  Recombinant Human SRP14 protein
Background:  Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. SRP9 together with SRP14 and the Alu portion of the SRP RNA, constitutes the elongation arrest domain of SRP. The complex of SRP9 and SRP14 is required for SRP RNA binding.
Applications:  Mass Spectrometry; SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  17 kDa including tags
Purity:  > 85 % SDS-PAGE. Purified by using conventional chromatography.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride
Accession#:  P37108
Alternative Names:  18 kDa Alu RNA binding protein/18 kDa Alu RNA-binding protein/Alu RNA-binding protein, 14-KD subunit
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMGSHMVLLESEQFLTELTRLFQKCRTSGSV YITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKK ISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTKAAAAAAAAA PAAAATAATTAATTAATAAQ
Sequence Similarities:  Belongs to the SRP14 family.
Expression System:  E. coli
Protein Length:  Full length protein; 1 to 160
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.