Recombinant Human BRD1/BRL protein (Tagged)


  • Specification
  • Related Products
Cat.No.:  PE-2866
Background:  Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
Applications:  SDS-PAGE
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Molecular Weight:  41 kDa including tags
Purity:  > 95 % SDS-PAGE.
Species:  Human
Accession#:  O95696
Alternative Names:  BR140-like protein/BRD1/BRD1_HUMAN
Amino Acid Sequence:  EQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKH PMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRL RDQGGVVLRQARREVDSIGLEEASG
Sequence Similarities:  Contains 1 bromo domain.Contains 1 PHD-type zinc finger.Contains 1 PWWP domain.
Expression System:  E. coli
Protein Length:  Protein fragment; 556 to 680
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart