Recombinant Human GATAD2B protein


  • Specification
  • Related Products
Cat.No.:  PE-2859
Product Name:  Recombinant Human GATAD2B protein
Background:  Has transcriptional repressor activity. Targets MBD3 to discrete loci in the nucleus.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  FLJ37346/GATA zinc finger domain containing 2B/GATA zinc finger domain containing protein 2B
Tag:  GST
Amino Acid Sequence:  RMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRK DLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENIND EPVDMSAR
Sequence Similarities:  Contains 1 GATA-type zinc finger.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 3 to 110
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.