Recombinant Human LRRFIP1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2856
Product Name:  Recombinant Human LRRFIP1 protein
Background:  Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  FLAP 1/FLAP1/FLIIAP 1
Tag:  GST
Amino Acid Sequence:  MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAE NAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSA LLSQQ
Sequence Similarities:  Belongs to the LRRFIP family.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 105
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.