Cat.No.: | PE-2855 |
Product Name: | Recombinant Human RUNX1 / AML1 protein |
Background: | CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits MYST4-dependent transcriptional activation. |
Applications: | Functional Studies; SDS-PAGE |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 33 kDa including tags |
Purity: | > 90 % SDS-PAGE. Expressed in E.coli as inclusion bodies, refolded, chromatographically purified and sterile filtered. |
Species: | Human |
Formulation: | pH: 8.00; Constituent: 0.32% Tris HClNote: Contains NaCl,EDTA,KCl,arginine,DTT and Glycerol |
Accession#: | Q01196-3 |
Alternative Names: | Acute myeloid leukemia 1/Acute myeloid leukemia 1 protein/alpha subunit core binding factor |
Amino Acid Sequence: | 29aa_Tag_RIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAG KLRSGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVV ALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGR GKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSL SFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQE EDTAPWRCLEESGGGGSPGRRRRRRRRRRR |
Sequence Similarities: | Contains 1 Runt domain. |
Expression System: | E. coli |
Post Translational Modifications: | Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with MYST3.Methylated. |
Protein Length: | Full length protein; 2 to 250 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0042 | Runx1/AML1-ETO Polyclonal Antibody | Inquiry |
EAb-0313 | RUNX2 Polyclonal Antibody | Inquiry |
◆ Extracts & Lysates | ||
EL-0092 | Recombinant Human RUNX2 293 Cell Lysate | Inquiry |
EL-0093 | Recombinant Human RUNX2 293 Cell Lysate | Inquiry |
◆ Proteins & Enzymes | ||
PE-0746 | Recombinant Human RUNX2 | Inquiry |
Related Gene / Proteins | |||
Runx1 | RUNX2 | RUVB2 | RUVBL1 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools