Recombinant Human SCYL1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2854
Product Name:  Recombinant Human SCYL1 protein
Background:  Regulates COPI-mediated retrograde traffic. Has no detectable kinase activity in vitro.Isoform 6 acts as transcriptional activator. It binds to three different types of GC-rich DNA binding sites (box-A, -B and -C) in the beta-polymerase promoter region. It also binds to the TERT promoter region.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Coated vesicle associated kinase of 90 kDa/Coated vesicle-associated kinase of 90 kDa/CVAK90
Tag:  GST
Amino Acid Sequence:  DHKSSKSPESDWSSWEAEGSWEQGWQEPSSQEPPPDGTRLASEYNWGGPE SSDKGDPFATLSARPSTQDRSRLSWPGRSARSGGGRWRPNAPRGRWPRAP
Sequence Similarities:  Belongs to the protein kinase superfamily.Contains 3 HEAT repeats.Contains 1 protein kinase domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 373 to 472
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.