Cat.No.: | PE-2846 |
Product Name: | Recombinant Human AUH protein |
Background: | AUH (3-methylglutaconyl-CoA hydratase) catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA and has very low enoyl-CoA hydratase activity. Deletion or mutation of the AUH gene causes the metabolic disease 3-methylglutaconic aciduria type I (MGA1). MGA type I is characterized by an abnormal organic acid profile in which there is excessive urinary excretion of 3-methylglutaconic acid, 3-methylglutaric acid and 3-hydroxyisovaleric acid. AUH is also an RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs. |
Applications: | SDS-PAGE; Mass Spectrometry |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 31 kDa including tags |
Purity: | > 95 % SDS-PAGE. Purified using conventional chromatography. |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride |
Accession#: | Q13825 |
Alternative Names: | 3 methylglutaconyl CoA hydratase/AU binding protein/enoyl CoA hydratase/AU RNA binding protein/enoyl CoA hydratase |
Tag: | His |
Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMSSEMKTEDELRVRHLEEENRGIVVLGINR AYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKER AKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDI RVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGK EAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQG MEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE |
Expression System: | E. coli |
Protein Length: | Full length protein; 68 to 339 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools