Recombinant Human AUH protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2846
Background:  AUH (3-methylglutaconyl-CoA hydratase) catalyzes the conversion of 3-methylglutaconyl-CoA to 3-hydroxy-3-methylglutaryl-CoA and has very low enoyl-CoA hydratase activity. Deletion or mutation of the AUH gene causes the metabolic disease 3-methylglutaconic aciduria type I (MGA1). MGA type I is characterized by an abnormal organic acid profile in which there is excessive urinary excretion of 3-methylglutaconic acid, 3-methylglutaric acid and 3-hydroxyisovaleric acid. AUH is also an RNA-binding protein that binds in vitro to clustered 5'-AUUUA-3' motifs.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  31 kDa including tags
Purity:  > 95 % SDS-PAGE. Purified using conventional chromatography.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride
Accession#:  Q13825
Alternative Names:  3 methylglutaconyl CoA hydratase/AU binding protein/enoyl CoA hydratase/AU RNA binding protein/enoyl CoA hydratase
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMSSEMKTEDELRVRHLEEENRGIVVLGINR AYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKER AKMSSSEVGPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDI RVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGK EAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQG MEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
Expression System:  E. coli
Protein Length:  Full length protein; 68 to 339
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Bioactive Small Molecules
BSM-0001 KW 2449 Inquiry
BSM-0002 AT9283 Inquiry
BSM-0003 PHA-680632 Inquiry
BSM-0004 TAK-901 Inquiry
BSM-0005 SQ 22536 Inquiry
Related Gene / Proteins
AUH Aurka AurkB AurkC

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.