Recombinant Human HMGA1a / HMGA1b protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2841
Background:  HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  13 kDa including tags
Purity:  > 90 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:  Human
Formulation:  pH: 8.00; Constituents: 50% Glycerol, 0.02% DTT, 0.32% Tris HCl, 1.12% Sodium chloride
Accession#:  P17096
Alternative Names:  High mobility group AT hook 1/High mobility group AT-hook protein 1/High mobility group protein A1
Tag:  His
Amino Acid Sequence:  MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSE VPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ ESSEEEQLEH HHHHH
Sequence Similarities:  Belongs to the HMGA family.Contains 3 A.T hook DNA-binding domains.
Expression System:  E. coli
Post Translational Modifications:  Constitutively phosphorylated on two or three sites. Phosphorylated upon DNA damage, probably by ATM or ATR. Hyperphosphorylated at early stages of apoptosis, followed by dephosphorylation and methylation, which coincides with chromatin condensation. Isoform HMG-Y can be phosphorylated by HIPK2.HMG-Y is not methylated.Methylation at Arg-58 is mutually exclusive with methylation at Arg-60.
Protein Length:  Full length protein; 1 to 107
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.