| Cat.No.: | PE-2841 |
| Product Name: | Recombinant Human HMGA1a / HMGA1b protein |
| Background: | HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 13 kDa including tags |
| Purity: | > 90 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 50% Glycerol, 0.02% DTT, 0.32% Tris HCl, 1.12% Sodium chloride |
| Accession#: | P17096 |
| Alternative Names: | High mobility group AT hook 1/High mobility group AT-hook protein 1/High mobility group protein A1 |
| Tag: | His |
| Amino Acid Sequence: | MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSE VPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ ESSEEEQLEH HHHHH |
| Sequence Similarities: | Belongs to the HMGA family.Contains 3 A.T hook DNA-binding domains. |
| Expression System: | E. coli |
| Post Translational Modifications: | Constitutively phosphorylated on two or three sites. Phosphorylated upon DNA damage, probably by ATM or ATR. Hyperphosphorylated at early stages of apoptosis, followed by dephosphorylation and methylation, which coincides with chromatin condensation. Isoform HMG-Y can be phosphorylated by HIPK2.HMG-Y is not methylated.Methylation at Arg-58 is mutually exclusive with methylation at Arg-60. |
| Protein Length: | Full length protein; 1 to 107 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
| EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
| EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
| EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
| EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools