Cat.No.: | PE-2833 |
Product Name: | Recombinant Human KAP1 protein (denatured) |
Background: | Nuclear corepressor for KRAB domain-containing zinc finger proteins (KRAB-ZFPs). Mediates gene silencing by recruiting CHD3, a subunit of the nucleosome remodeling and deacetylation (NuRD) complex, and SETDB1 (which specifically methylates histone H3 at 'Lys-9' (H3K9me)) to the promoter regions of KRAB target genes. Enhances transcriptional repression by coordinating the increase in H3K9me, the decrease in histone H3 'Lys-9 and 'Lys-14' acetylation (H3K9ac and H3K14ac, respectively) and the disposition of HP1 proteins to silence gene expression. Recruitment of SETDB1 induces heterochromatinization. May play a role as a coactivator for CEBPB and NR3C1 in the transcriptional activation of ORM1. Also corepressor for ERBB4. Inhibits E2F1 activity by stimulating E2F1-HDAC1 complex formation and inhibiting E2F1 acetylation. May serve as a partial backup to prevent E2F1-mediated apoptosis in the absence of RB1. Important regulator of CDKN1A/p21(CIP1). Has E3 SUMO-protein ligase activity toward itself via its PHD-type zinc finger. |
Applications: | SDS-PAGE |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Molecular Weight: | 49 kDa including tags |
Purity: | > 90 % SDS-PAGE. |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol |
Accession#: | Q13263 |
Alternative Names: | E3 SUMO protein ligase TRIM28/E3 SUMO-protein ligase TRIM28/FLJ29029 |
Tag: | His |
Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSKLIYFQLHRALKMIVDPVEPHGEMKFQ WDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQP MEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLER LDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAGTP GAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRL ASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQ CEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGV VAKLSPANQRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTL IRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFF ETRMNEAFGD |
Sequence Similarities: | Belongs to the TRIM/RBCC family.Contains 2 B box-type zinc fingers.Contains 1 bromo domain.Contains 1 PHD-type zinc finger.Contains 1 RING-type zinc finger. |
Expression System: | E. coli |
Post Translational Modifications: | Phosphorylated upon DNA damage, probably by ATM or ATR. ATM-induced phosphorylation on Ser-824 represses sumoylation leading to the de-repression of expression of a subset of genes involved in cell cycle control and apoptosis in response to genotoxic stress. Dephosphorylation by the phosphatases, PPP1CA and PP1CB forms, allows sumoylation and expression of TRIM28 target genes.Sumoylation/desumoylation events regulate TRIM28-mediated transcriptional repression. Sumoylation is required for interaction with CHD3 and SETDB1 and the corepressor activity. Represses and is repressed by Ser-824 phosphorylation. Enhances the TRIM28 corepressor activity, inhibiting transcriptional activity of a number of genes including GADD45A and CDKN1A/p21. Lys-554, Lys-779 and Lys-804 are the major sites of sumoylation. In response to Dox-induced DNA damage, enhanced phosphorylation on Ser-824 prevents sumoylation and allows de-repression of CDKN1A/p21. |
Protein Length: | Protein fragment; 366 to 802 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Bioactive Small Molecules | ||
BSM-0073 | Anacardic Acid | Inquiry |
◆ Antibodies | ||
EAb-0073 | KAT8 Polyclonal Antibody | Inquiry |
◆ Cell Lines | ||
CL-0083 | Human KAT2A Knockout Cell Line 1bp insertion | Inquiry |
CL-0085 | Human KAT2B Knockout Cell Line 31bp deletion | Inquiry |
◆ Extracts & Lysates | ||
EL-0159 | Recombinant Human MYST2 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
Kaiso | KANSL2 | KAP1 | KAT13A |
KAT13D | KAT2A | KAT2B | KAT4 |
KAT5 | KAT6A | KAT6B | KAT7 |
KAT8 | KAT9 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools