| Cat.No.: | PE-2829 |
| Product Name: | Recombinant Human MORC3 protein (Tagged) |
| Background: | Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233). |
| Applications: | SDS-PAGE |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 49 kDa including tags |
| Purity: | > 90 % SDS-PAGE. |
| Species: | Human |
| Formulation: | Constituents: 50% Glycerol, Tris buffer |
| Accession#: | Q14149 |
| Alternative Names: | KIAA0136/Microrchidia 3/MORC family CW type zinc finger 3 |
| Tag: | His |
| Amino Acid Sequence: | MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQI WIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLY GNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAF NKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWN LRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYS LRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY |
| Sequence Similarities: | Contains 1 CW-type zinc finger. |
| Expression System: | E. coli |
| Post Translational Modifications: | Sumoylation is involved in interaction with PML and localization to PML nuclear bodies. |
| Protein Length: | Protein fragment; 1 to 290 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0174 | MOZ-IN-3 | Inquiry |
| ◆ Synthetic Peptides | ||
| SP-0174 | Human KAT8 / MYST1 / MOF peptide | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0221 | Recombinant Human MORF4L2 293 Cell Lysate | Inquiry |
| ◆ Antibodies | ||
| EAb-0695 | MORC2 Polyclonal Antibody | Inquiry |
| EAb-0779 | MORC2 Polyclonal Antibody, HRP Conjugated | Inquiry |
| Related Gene / Proteins | |||
| MOF | MORC2 | MORC3 | MORF |
| MORF4L2 | MOZ | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
