| Cat.No.: | PE-2812 |
| Background: | Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | FLAP 1/FLAP1/FLIIAP 1 |
| Tag: | GST |
| Amino Acid Sequence: | GVAKDNAKIDGATQSSPAEPKSEDADRCTLPEHESPSQDISDACEAESTE RCEMSEHPSQTVRKALDSNSLENDDLSAPGREPGHFNPESREDTRGGNEK GKSKEDCTMS |
| Sequence Similarities: | Belongs to the LRRFIP family. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 675 to 784 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0402 | Human LRIF1 Knockout Cell Line | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-0430 | Recombinant Mouse LRWD1 Protein | Inquiry |
| PE-0431 | Recombinant Rhesus monkey LRWD1 Protein, His-tagged | Inquiry |
| ◆ Antibodies | ||
| EAb-1166 | LRRC29 Polyclonal Antibody, HRP Conjugated | Inquiry |
| EAb-1275 | LRRC29 Polyclonal Antibody, FITC Conjugated | Inquiry |
| Related Gene / Proteins | |||
| LRIF1 | LRRC29 | LRRFIP1 | LRWD1 |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.