| Cat.No.: | PE-2807 |
| Product Name: | Recombinant Human PCBP2/hnRNP E2 protein |
| Background: | Single-stranded nucleic acid binding protein that binds preferentially to oligo dC. Major cellular poly(rC)-binding protein. Binds also poly(rU). Negatively regulates cellular antiviral responses mediated by MAVS signaling. It acts as an adapter between MAVS and the E3 ubiquitin ligase ITCH, therefore triggering MAVS ubiquitinationa and degradation. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Alpha CP2/Alpha-CP2/alphaCP-2 |
| Tag: | GST |
| Amino Acid Sequence: | VTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPL EAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKG YWAGLDASAQ |
| Sequence Similarities: | Contains 3 KH domains. |
| Expression System: | Wheat germ |
| Post Translational Modifications: | Phosphorylated. The non-phosphorylated form(s) exhibited the strongest poly(rC)-binding activity. |
| Protein Length: | Protein fragment; 174 to 283 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0039 | Embelin | Inquiry |
| BSM-0108 | Curcumin, Curcuma longa (High Purity) | Inquiry |
| BSM-0133 | Garcinol | Inquiry |
| ◆ Antibodies | ||
| EAb-0060 | PCAF Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0106 | Recombinant Human PCNA Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| PCAF | PCBP2 | PCBP3 | PCBP4 |
| PCGF2 | PCGF6 | PCL2 | PCNA |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools