| Cat.No.: | PE-2805 |
| Background: | Binds preferentially single-stranded DNA and unwinds double stranded DNA. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 23 kDa including tags |
| Purity: | > 85 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride |
| Accession#: | O15347 |
| Alternative Names: | chromosomal protein, Nonhistone, HMG4/High mobility group (nonhistone chromosomal) protein 4/High mobility group box 3 |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSMAKGDPKKPKGKMSAYAFFVQTCREEH KKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKD YGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISIGDVAKKL GEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVAR KKV |
| Sequence Similarities: | Belongs to the HMGB family.Contains 2 HMG box DNA-binding domains. |
| Expression System: | E. coli |
| Protein Length: | Protein fragment; 1 to 180 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0084 | HMG2L1 Polyclonal Antibody | Inquiry |
| EAb-0293 | HMGB4 Polyclonal Antibody | Inquiry |
| EAb-0309 | HMGB3 Polyclonal Antibody | Inquiry |
| EAb-0329 | HMGB1 Polyclonal Antibody | Inquiry |
| EAb-0333 | HMGB1 Polyclonal Antibody | Inquiry |
| Related Gene / Proteins | |||
| HMG-1 | HMG2L1 | HMG4 | HMGA1 |
| HMGA2 | HMGB1 | HMGB2 | HMGB3 |
| HMGB4 | HMGN1 | HMGN2 | HMGN3 |
| HMGN5 | HMT1 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.