| Cat.No.: | PE-2800 |
| Product Name: | Recombinant Human RBM3 protein |
| Background: | Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphoryaltion of translation initiation factors and active polysome formation. |
| Applications: | SDS-PAGE; Mass Spectrometry |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Molecular Weight: | 19 kDa including tags |
| Purity: | > 95 % SDS-PAGE. Purified using conventional chromatography techniques. |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.08% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride |
| Accession#: | P98179 |
| Alternative Names: | 2600016C11Rik/IS1 RNPL/MGC105811 |
| Tag: | His |
| Amino Acid Sequence: | MGSSHHHHHHSSGLVPRGSHMGSMSSEEGKLFVGGLNFNTDEQALEDHFS SFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQI RVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGY GYGRSRDYNGRNQGGYDRYSGGNYRDNYDN |
| Sequence Similarities: | Contains 1 RRM (RNA recognition motif) domain. |
| Expression System: | E. coli |
| Post Translational Modifications: | Arg-105 is dimethylated, probably to asymmetric dimethylarginine.Phosphorylated. |
| Protein Length: | Full length protein; 1 to 157 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0043 | RBBP4 Polyclonal Antibody | Inquiry |
| EAb-0181 | RBM26 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0047 | Recombinant Human RBBP4 Cell Lysate | Inquiry |
| EL-0216 | Recombinant Human RBBP5 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0118 | Human RBBP7 Knockout Cell Line 5bp deletion | Inquiry |
| Related Gene / Proteins | |||
| RB1 | RbAp46 | RbAp48 | RBB4L |
| RBBP2 | RBBP4 | RBBP5 | RBBP7 |
| RBBP9 | RBM11 | RBM18 | RBM26 |
| RBM3 | RBM34 | RBM38 | RBM39 |
| RBM41 | RBM42 | RBM46 | RBM5 More > |
| RBM7 | RBMS1 | RBMS2 | RBMS3 |
| RBMY1A1 | RBMY1F | RBPJ | RBPMS |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools