Recombinant Human RBM3 protein


  • Specification
  • Related Products
Cat.No.:  PE-2800
Background:  Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphoryaltion of translation initiation factors and active polysome formation.
Applications:  SDS-PAGE; Mass Spectrometry
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Molecular Weight:  19 kDa including tags
Purity:  > 95 % SDS-PAGE. Purified using conventional chromatography techniques.
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.08% DTT, 0.32% Tris HCl, 50% Glycerol, 1.17% Sodium chloride
Accession#:  P98179
Alternative Names:  2600016C11Rik/IS1 RNPL/MGC105811
Tag:  His
Amino Acid Sequence:  MGSSHHHHHHSSGLVPRGSHMGSMSSEEGKLFVGGLNFNTDEQALEDHFS SFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQI RVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGY GYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Sequence Similarities:  Contains 1 RRM (RNA recognition motif) domain.
Expression System:  E. coli
Post Translational Modifications:  Arg-105 is dimethylated, probably to asymmetric dimethylarginine.Phosphorylated.
Protein Length:  Full length protein; 1 to 157
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart