Recombinant Human RBM38 protein


  • Specification
  • Related Products
Cat.No.:  PE-2789
Product Name:  Recombinant Human RBM38 protein
Background:  RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  CLL associated antigen KW 5/CLL-associated antigen KW-5/HSRNASEB
Tag:  GST
Amino Acid Sequence:  MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASL RKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIID GRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAI VQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAA SFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Sequence Similarities:  Belongs to the RBM38 family.Contains 1 RRM (RNA recognition motif) domain.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 239
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.