| Cat.No.: | PE-2789 |
| Background: | RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | CLL associated antigen KW 5/CLL-associated antigen KW-5/HSRNASEB |
| Tag: | GST |
| Amino Acid Sequence: | MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASL RKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIID GRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAI VQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAA SFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ |
| Sequence Similarities: | Belongs to the RBM38 family.Contains 1 RRM (RNA recognition motif) domain. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 239 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0043 | RBBP4 Polyclonal Antibody | Inquiry |
| EAb-0181 | RBM26 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0047 | Recombinant Human RBBP4 Cell Lysate | Inquiry |
| EL-0216 | Recombinant Human RBBP5 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0118 | Human RBBP7 Knockout Cell Line 5bp deletion | Inquiry |
| Related Gene / Proteins | |||
| RB1 | RbAp46 | RbAp48 | RBB4L |
| RBBP2 | RBBP4 | RBBP5 | RBBP7 |
| RBBP9 | RBM11 | RBM18 | RBM26 |
| RBM3 | RBM34 | RBM38 | RBM39 |
| RBM41 | RBM42 | RBM46 | RBM5 More > |
| RBM7 | RBMS1 | RBMS2 | RBMS3 |
| RBMY1A1 | RBMY1F | RBPJ | RBPMS |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.