| Cat.No.: | PE-2784 |
| Product Name: | Recombinant Human RBMS1 protein |
| Background: | Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication. |
| Applications: | Western blot; ELISA |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | c myc gene single strand binding protein 2/C2orf12/Cervical cancer oncogene 4 |
| Tag: | GST |
| Amino Acid Sequence: | YIASPVSAYQVQSPSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPL AQQMSHLSLGSTGTYMPATSAMQGAYLPQYAHMQTTAVPV |
| Sequence Similarities: | Contains 2 RRM (RNA recognition motif) domains. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 291 to 380 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0043 | RBBP4 Polyclonal Antibody | Inquiry |
| EAb-0181 | RBM26 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0047 | Recombinant Human RBBP4 Cell Lysate | Inquiry |
| EL-0216 | Recombinant Human RBBP5 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0118 | Human RBBP7 Knockout Cell Line 5bp deletion | Inquiry |
| Related Gene / Proteins | |||
| RB1 | RbAp46 | RbAp48 | RBB4L |
| RBBP2 | RBBP4 | RBBP5 | RBBP7 |
| RBBP9 | RBM11 | RBM18 | RBM26 |
| RBM3 | RBM34 | RBM38 | RBM39 |
| RBM41 | RBM42 | RBM46 | RBM5 More > |
| RBM7 | RBMS1 | RBMS2 | RBMS3 |
| RBMY1A1 | RBMY1F | RBPJ | RBPMS |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools