Recombinant Human RNF141 protein


  • Specification
  • Related Products
Cat.No.:  PE-2775
Product Name:  Recombinant Human RNF141 protein
Background:  May be involved in spermatogenesis.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  2610110L04Rik/AA792898/AU022812
Tag:  GST
Amino Acid Sequence:  LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPI CRLQMTGANESWVVSDAPTEDDMANYILNMADEAGQPHR
Sequence Similarities:  Contains 1 RING-type zinc finger.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 141 to 229
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.