| Cat.No.: | PE-2771 |
| Background: | Functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | HSU24186/MGC120333/MGC120334 |
| Tag: | GST |
| Amino Acid Sequence: | MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCN VNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAK PIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLED MNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNF IQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYP TVDREHFKSAD |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 261 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Proteins & Enzymes | ||
| PE-2577 | Recombinant Human RPL22 protein | Inquiry |
| PE-2604 | Recombinant Human RPL7 protein | Inquiry |
| PE-2767 | Recombinant Human RPL37 protein | Inquiry |
| PE-2768 | Recombinant Human RPL37 protein | Inquiry |
| PE-2769 | Recombinant Human RPF1 protein | Inquiry |
| Related Gene / Proteins | |||
| RPA4 | RPF1 | RPL22 | RPL37 |
| RPL7 | RPS6KA4 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.
