Recombinant Human RPA4 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2770
Background:  Functions as component of the alternative replication protein A complex (aRPA). aRPA binds single-stranded DNA and probably plays a role in DNA repair; it does not support chromosomal DNA replication and cell cycle progression through S-phase. In vitro, aRPA cannot promote efficient priming by DNA polymerase alpha but supports DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  HSU24186/MGC120333/MGC120334
Tag:  GST
Amino Acid Sequence:  EKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKC PTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESV
Expression System:  Wheat germ
Protein Length:  Protein fragment; 84 to 180
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.