Recombinant Human STAU2 protein

Inquiry

  • Specification
  • Related Products
Cat.No.:  PE-2758
Background:  RNA-binding protein required for the microtubule-dependent transport of neuronal RNA from the cell body to the dendrite. As protein synthesis occurs within the dendrite, the localization of specific mRNAs to dendrites may be a prerequisite for neurite outgrowth and plasticity at sites distant from the cell body.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  39K2/39K3/DKFZp781K0371
Tag:  GST
Amino Acid Sequence:  LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTLPKPVQKPP KSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFP
Sequence Similarities:  Contains 4 DRBM (double-stranded RNA-binding) domains.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 2 to 90
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Privacy Policy | Cookie Policy

Copyright © 2026 CD BioSciences. All Rights Reserved.