Recombinant Human SUV3L1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2756
Product Name:  Recombinant Human SUV3L1 protein
Background:  Major helicase player in mitochondrial RNA metabolism. Component of the mitochondrial degradosome (mtEXO) complex, that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. ATPase and ATP-dependent multisubstrate helicase, able to unwind double-stranded (ds) DNA and RNA, and RNA/DNA heteroduplexes in the 5'-to-3' direction. Plays a role in the RNA surveillance system in mitochondria; regulates the stability of mature mRNAs, the removal of aberrantly formed mRNAs and the rapid degradation of non coding processing intermediates. Also implicated in recombination and chromatin maintenance pathways. May protect cells from apoptosis. Associates with mitochondrial DNA.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  6330443E10Rik/ATP dependent RNA helicase SUPV3L1, mitochondrial/ATP-dependent RNA helicase SUPV3L1
Tag:  GST
Amino Acid Sequence:  NLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKATEPPSPDAGELSLASR LVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKKKEPDSD
Sequence Similarities:  Belongs to the helicase family.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 687 to 786
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.