Cat.No.: | PE-2756 |
Product Name: | Recombinant Human SUV3L1 protein |
Background: | Major helicase player in mitochondrial RNA metabolism. Component of the mitochondrial degradosome (mtEXO) complex, that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. ATPase and ATP-dependent multisubstrate helicase, able to unwind double-stranded (ds) DNA and RNA, and RNA/DNA heteroduplexes in the 5'-to-3' direction. Plays a role in the RNA surveillance system in mitochondria; regulates the stability of mature mRNAs, the removal of aberrantly formed mRNAs and the rapid degradation of non coding processing intermediates. Also implicated in recombination and chromatin maintenance pathways. May protect cells from apoptosis. Associates with mitochondrial DNA. |
Applications: | Western blot; ELISA |
Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
Appearance: | Liquid |
Species: | Human |
Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
Alternative Names: | 6330443E10Rik/ATP dependent RNA helicase SUPV3L1, mitochondrial/ATP-dependent RNA helicase SUPV3L1 |
Tag: | GST |
Amino Acid Sequence: | NLEGFPSGSQSRLSGTLKSQARRTRGTKALGSKATEPPSPDAGELSLASR LVQQGLLTPDMLKQLEKEWMTQQTEHNKEKTESGTHPKGTRRKKKEPDSD |
Sequence Similarities: | Belongs to the helicase family.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
Expression System: | Wheat germ |
Protein Length: | Protein fragment; 687 to 786 |
Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
Product Types | ||
◆ Antibodies | ||
EAb-0020 | Suz12 Polyclonal Antibody | Inquiry |
◆ Bioactive Small Molecules | ||
BSM-0100 | Chaetocin | Inquiry |
◆ Extracts & Lysates | ||
EL-0103 | Recombinant Human SUZ12 293 Cell Lysate | Inquiry |
EL-0132 | Recombinant Human SUV39H1 293 Cell Lysate | Inquiry |
EL-0137 | Recombinant Human SUV420H1 293 Cell Lysate | Inquiry |
Related Gene / Proteins | |||
SUDS3 | SUMO | SUMO1 | SUMO2 |
SUMO3 | SUN1 | Surf6 | suv39h1 |
SUV39H2 | SUV3L1 | SUV420H1 | SUV420H2 |
SUZ12 |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools