| Cat.No.: | PE-2755 |
| Background: | Regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | TMEM113/MST107/MSTP107 |
| Tag: | GST |
| Amino Acid Sequence: | MPSLPTTNCVHSLQMIPPLSPAPNQELVLGLCYMSYLAFLYMTFDFCCLY FSTVYAPSFKYICVHTDTHICVCVCIYLSSVVSKSSAEADGVLQPRRHPA SLLIVFATSISESSLLIFSFQKTEAKLIVFAVSLAAK |
| Sequence Similarities: | Belongs to the WD repeat SWD2 family.Contains 6 WD repeats. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 137 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0018 | Swi6 Polyclonal Antibody | Inquiry |
| EAb-0784 | Swi2/SNF2 Polyclonal Antibody | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2755 | Recombinant Human Swd2 protein | Inquiry |
| Related Gene / Proteins | |||
| Swd2 | Swi2 | Swi6 | |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.