Recombinant Human Swd2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2755
Product Name:  Recombinant Human Swd2 protein
Background:  Regulatory component of the SET1 complex implicated in the tethering of this complex to transcriptional start sites of active genes. Facilitates histone H3 'Lys-4' methylation via recruitment of the SETD1A or SETD1B to the 'Ser-5' phosphorylated C-terminal domain (CTD) of RNA polymerase II large subunit (POLR2A). Component of PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  TMEM113/MST107/MSTP107
Tag:  GST
Amino Acid Sequence:  MPSLPTTNCVHSLQMIPPLSPAPNQELVLGLCYMSYLAFLYMTFDFCCLY FSTVYAPSFKYICVHTDTHICVCVCIYLSSVVSKSSAEADGVLQPRRHPA SLLIVFATSISESSLLIFSFQKTEAKLIVFAVSLAAK
Sequence Similarities:  Belongs to the WD repeat SWD2 family.Contains 6 WD repeats.
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 137
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Antibodies
EAb-0018 Swi6 Polyclonal Antibody Inquiry
EAb-0784 Swi2/SNF2 Polyclonal Antibody Inquiry
◆ Proteins & Enzymes
PE-2755 Recombinant Human Swd2 protein Inquiry
Related Gene / Proteins
Swd2 Swi2 Swi6

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.