| Cat.No.: | PE-2743 |
| Product Name: | Recombinant Human WDHD1 protein |
| Background: | The protein WDHD1 contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Acidic nucleoplasmic DNA binding protein 1/And 1/And1 |
| Tag: | GST |
| Amino Acid Sequence: | SNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEA KKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQ |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 1031 to 1128 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Antibodies | ||
| EAb-0005 | WDR5 Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0052 | Recombinant Human WDTC1 293 Cell Lysate | Inquiry |
| ◆ Bioactive Small Molecules | ||
| BSM-0187 | OICR-9429 | Inquiry |
| BSM-0256 | WDR5 0103 | Inquiry |
| BSM-0335 | MM-102 | Inquiry |
| Related Gene / Proteins | |||
| WDHD1 | WDR4 | WDR5 | WDR77 |
| WDR82 | WDTC1 | ||
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
