Recombinant Human WDHD1 protein


  • Specification
  • Related Products
Cat.No.:  PE-2743
Product Name:  Recombinant Human WDHD1 protein
Background:  The protein WDHD1 contains multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WD40 domains are found in a variety of eukaryotic proteins and may function as adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. Alternative splicing results in two transcript variants encoding different isoforms.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Acidic nucleoplasmic DNA binding protein 1/And 1/And1
Tag:  GST
Amino Acid Sequence:  SNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEA KKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQ
Expression System:  Wheat germ
Protein Length:  Protein fragment; 1031 to 1128
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.
Product Types
◆ Antibodies
EAb-0005 WDR5 Polyclonal Antibody Inquiry
◆ Extracts & Lysates
EL-0052 Recombinant Human WDTC1 293 Cell Lysate Inquiry
◆ Bioactive Small Molecules
BSM-0187 OICR-9429 Inquiry
BSM-0256 WDR5 0103 Inquiry
BSM-0335 MM-102 Inquiry
Related Gene / Proteins
WDHD1 WDR4 WDR5 WDR77
WDR82 WDTC1

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.