| Cat.No.: | PE-2737 |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Cellular nucleic acid binding protein like/Cnbp2/ZCCHC 13 |
| Tag: | GST |
| Amino Acid Sequence: | MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCC GESGRNAKNCVLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHL ARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQ LLPLRQIPTSSQGMSQ |
| Sequence Similarities: | Contains 6 CCHC-type zinc fingers. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 166 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Cell Lines | ||
| CL-0385 | Human ZC3HAV1 Knockout Cell Line | Inquiry |
| ◆ Proteins & Enzymes | ||
| PE-2725 | Recombinant Human ZCCHC6 protein | Inquiry |
| PE-2736 | Recombinant Human ZCCHC2 protein | Inquiry |
| PE-2737 | Recombinant Human ZCCHC13 protein | Inquiry |
| PE-2738 | Recombinant Human ZCCHC10 protein | Inquiry |
| Related Gene / Proteins | |||
| ZC3H14 | ZC3HAV1 | ZCCHC10 | ZCCHC13 |
| ZCCHC2 | ZCCHC6 | ||
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.