| Cat.No.: | PE-2730 |
| Product Name: | Recombinant Human Zmat2 protein |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | FLJ31121/Zinc finger matrin type 2/Zinc finger matrin-type protein 2 |
| Tag: | GST |
| Amino Acid Sequence: | MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLR HRDYKVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHIN GKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKMEEKQKDYDFEERMKELR EEEEKAKAYKKEKQKEKKRRAEEDLTFEEDDEMAAVMGFSGFGSTKKSY |
| Sequence Similarities: | Contains 1 matrin-type zinc finger. |
| Expression System: | Wheat germ |
| Protein Length: | Full length protein; 1 to 199 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Extracts & Lysates | ||
| EL-0097 | Recombinant Human ZMYND11 293 Cell Lysate | Inquiry |
| ◆ Cell Lines | ||
| CL-0224 | Human ZMYM3 Knockout Cell Line 2bp deletion | Inquiry |
| CL-0225 | Human ZMYND8 Knockout Cell Line 8bp deletion | Inquiry |
| CL-0226 | Human ZMYND11 Knockout Cell Line 31bp deletion | Inquiry |
| CL-0476 | Human ZMYND11 Knockout Cell Line 31bp deletion | Inquiry |
| Related Gene / Proteins | |||
| Zmat2 | ZMAT4 | ZMIZ2 | ZMYM3 |
| ZMYND11 | ZMYND15 | ZMYND8 | |
USA
Enter your email here to subscribe.
Easy access to products and services you need from our library via powerful searching tools
