Recombinant Human TRIM26 protein


  • Specification
  • Related Products
Cat.No.:  PE-2720
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  Acid finger protein/AFP/CAM25547
Tag:  GST
Amino Acid Sequence:  REKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQG HQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
Sequence Similarities:  Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 B30.2/SPRY domain.Contains 1 RING-type zinc finger.
Expression System:  Wheat germ
Protein Length:  Protein fragment; 146 to 240
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart