Recombinant Human PABPC5 protein


  • Specification
  • Related Products
Cat.No.:  PE-2715
Product Name:  Recombinant Human PABPC5 protein
Background:  PABPC5 (polyadenylate-binding protein 5) binds the polyadenylate tail of mRNA and is thought to be involved in cytoplasmic regulatory processes of mRNA metabolism. In vivo, it may also bind to cytoplasmic RNA sequences other than polyadenylate.
Applications:  Western blot; ELISA
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  PABP5/Poly(A) binding protein 5/Poly(A) binding protein cytoplasmic 5
Tag:  GST
Amino Acid Sequence:  PGVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFS SFEEATKAVDEMNGRIVGSKPLHVTLGQARRRC
Expression System:  Wheat germ
Protein Length:  Protein fragment; 300 to 382
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Enter your email here to subscribe.

Easy access to products and services you need from our library via powerful searching tools

Copyright © Creative BioMart. All Rights Reserved.