| Cat.No.: | PE-2713 |
| Background: | Single-stranded nucleic acid binding protein that binds preferentially to oligo dC. |
| Applications: | ELISA; Western blot |
| Storage: | Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles. |
| Appearance: | Liquid |
| Species: | Human |
| Formulation: | pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl |
| Alternative Names: | Alpha CP4/Alpha-CP4/LIP4 |
| Tag: | GST |
| Amino Acid Sequence: | TTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGAT IPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSSHAVPFATP SVVPGLDPGT |
| Sequence Similarities: | Contains 3 KH domains. |
| Expression System: | Wheat germ |
| Protein Length: | Protein fragment; 130 to 239 |
| Warning: | This product is for research use only. Not for use in diagnostic or therapeutic procedures. |
| Product Types | ||
| ◆ Bioactive Small Molecules | ||
| BSM-0039 | Embelin | Inquiry |
| BSM-0108 | Curcumin, Curcuma longa (High Purity) | Inquiry |
| BSM-0133 | Garcinol | Inquiry |
| ◆ Antibodies | ||
| EAb-0060 | PCAF Polyclonal Antibody | Inquiry |
| ◆ Extracts & Lysates | ||
| EL-0106 | Recombinant Human PCNA Cell Lysate | Inquiry |
| Related Gene / Proteins | |||
| PCAF | PCBP2 | PCBP3 | PCBP4 |
| PCGF2 | PCGF6 | PCL2 | PCNA |
USA
Quick Links
Easy access to products and services you need from our library via powerful searching tools
Privacy Policy | Cookie Policy
Copyright © 2026 CD BioSciences. All Rights Reserved.