Recombinant Human PRIM2 protein


  • Specification
  • Related Products
Cat.No.:  PE-2709
Background:  PRIM2 synthesizes small ribonucleotide primers for the initiation of DNA replication. The eukaryotic primase is a heterodimer of a small and a large subunit, p49 and p58 respectively. These two subunits purify as a complex tightly bound to DNA polymerase alpha. This tight association implicates polymerase alpha as the lagging-strand DNA polymerase in replication. Uniquely, primases are able to synthesize nucleotides de novo on a template by the formation of an initial dinucleotide. PRIM2 initiates synthesis with a triphosphate purine moiety at the 5'-end. After synthesis of 7-10 ribonucleotides, the primer template is translocated intramolecularly to the active site of the DNA polymerase alpha subunit. The p49 subunit of PRIM2 contains the catalytic active site. The human primase subunits are 90% identical in amino acid sequence to the mouse homologs.
Applications:  ELISA; Western blot
Storage:  Store at 4℃ if entire vial will be used within 2-4 weeks. Store at -20℃ or -80℃ for longer periods of time. Avoid multiple freeze-thaw cycles.
Appearance:  Liquid
Species:  Human
Formulation:  pH: 8.00; Constituents: 0.31% Glutathione, 0.79% Tris HCl
Alternative Names:  dJ422B11.1.1/DNA Primase/DNA primase 58kDa subunit
Tag:  GST
Amino Acid Sequence:  MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRV KLLKSVENLGVSYVKGTEQYQSKLESELRKLKFSYRENLEDEYEPRRRDH ISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKIQDFLKDSQLQ FEAVSIFL
Expression System:  Wheat germ
Protein Length:  Full length protein; 1 to 158
Warning:  This product is for research use only. Not for use in diagnostic or therapeutic procedures.

Online Inquiry

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

Get Free Quote

For Research Use Only. Not for use in diagnostic or therapeutic procedures.

USA

Easy access to products and services you need from our library via powerful searching tools

Copyright © CD BioSciences. All Rights Reserved.
0
Shopping Cart